PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.LA5WR
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 352aa    MW: 39900.2 Da    PI: 8.812
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.LA5WRgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61e-3186139255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  prlrWtp+LH +Fv+av++LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  Araip.LA5WR  86 PRLRWTPDLHLSFVHAVQRLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 139
                  8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.31682142IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2982140IPR009057Homeodomain-like
SuperFamilySSF466892.51E-1484140IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-2386141IPR006447Myb domain, plants
PfamPF002498.1E-987138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MSEGFEIHQE NNEGSGGKSS NDNEGEENSF DLNEGAGMSD DEELEEENNN NEAKEDEETN  60
PSSSSTASRE GKRGSGVRQY VRSKMPRLRW TPDLHLSFVH AVQRLGGQER ATPKLVLQLM  120
NVRGLSIAHV KSHLQMYRSK KLDDSGQVVR SERQRSKHEV GGVAYETMMK RSSPHQHFKM  180
GNGGIFLTTN YTTTTPFSSL PHSKPTNHHL WHLNHQIPSI RRPITPPLQT QLASRITPMR  240
PSRFLEEKKW PPFHHWKFKR LPNTNTITLP SSQSSPFATT SDFITFGDNT TTTIRDYLSN  300
SNTFKLNHQD KQLQHKEKQW VPDLQLGLSH HKDGDNNDGT GTPEISTKLS LS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016191359.10.0PREDICTED: transcription repressor KAN1-like
RefseqXP_016191360.10.0PREDICTED: transcription repressor KAN1-like
RefseqXP_016191363.10.0PREDICTED: transcription repressor KAN1-like
TrEMBLA0A0B2PL142e-92A0A0B2PL14_GLYSO; Putative Myb family transcription factor
TrEMBLK7M1B42e-92K7M1B4_SOYBN; Uncharacterized protein
STRINGGLYMA13G30154.17e-92(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-39G2-like family protein